PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Seita.9G165800.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family G2-like
Protein Properties Length: 408aa    MW: 44161.7 Da    PI: 10.3052
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Seita.9G165800.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like100.11.5e-31140193255
             G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                         pr+rWt+ LH++Fv+ave LGG+e+AtPk++lelm+vk+Ltl+hvkSHLQ+YR+
  Seita.9G165800.1.p 140 PRMRWTTALHAHFVHAVELLGGHERATPKSVLELMNVKDLTLAHVKSHLQMYRT 193
                         9****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466892.51E-15137193IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.7E-28137193IPR009057Homeodomain-like
TIGRFAMsTIGR015575.4E-23140193IPR006447Myb domain, plants
PfamPF002493.4E-7141192IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 408 aa     Download sequence    Send to blast
MSYATHDLIT KIHFSSNKNR HSSILNLEVP HKLAMAATAA ATDLSLHISP PSPADAGSSG  60
GGGGEAYHET EGFFAAKPKL CLGLETATAQ QDGQSDTQQQ RLHQPSQIQR FKKSSPAALS  120
GGTTRSGNGS GGGKRSSRAP RMRWTTALHA HFVHAVELLG GHERATPKSV LELMNVKDLT  180
LAHVKSHLQM YRTVKGTTAD RSCAAGHVQM RDMGFLQRGC EVNGFEAFNH ITTSNTRMLA  240
AGKQEVAWCL RPPFAHQSGL PLPLPCPYLM SAHHNRYLLS QDHHQGWRRG AQQDVLGQDN  300
VARRLHTGLA DTAVRRSNWS AGVASRWSST AVPSPSMTGG RSISGSSEQG CWMTAMNKQQ  360
QQQAPSRIAA VPNLEISLGR QGWQHNLQDQ QQRSGESAKE LTLLKCL*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0373981e-120BT037398.1 Zea mays full-length cDNA clone ZM_BFb0167O11 mRNA, complete cds.
GenBankKJ7268281e-120KJ726828.1 Zea mays clone pUT3368 G2-like transcription factor (GLK23) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004982402.10.0PREDICTED: uncharacterized protein LOC101779847
TrEMBLA0A0A9GJU41e-167A0A0A9GJU4_ARUDO; Uncharacterized protein
STRINGGRMZM2G039074_P021e-114(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP37423168
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G42630.23e-32G2-like family protein